PDB entry 2gyb

View 2gyb on RCSB PDB site
Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
Class: ribosome
Keywords: SecM; nascent chain; signal transduction; RNA world; polypeptide exit tunnel; translocation; ribosome; elongation arrest; protein-conducting channel
Deposited on 2006-05-09, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 15 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 16S ribosomal RNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'B':
  Compound: 30S ribosomal subunit protein S2
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V0 (0-235)
  Domains in SCOPe 2.08: d2gybb1
• Chain 'C':
  Compound: 30S ribosomal subunit protein S3
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V3 (0-205)
• Chain 'D':
  Compound: 30S ribosomal subunit protein S4
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7V8 (0-203)
  Domains in SCOPe 2.08: d2gybd1
• Chain 'E':
  Compound: 30S ribosomal subunit protein S5
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W1 (0-147)
• Chain 'F':
  Compound: 30S ribosomal subunit protein S6
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02358 (0-94)
• Chain 'G':
  Compound: 30S ribosomal subunit protein S7
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02359 (0-136)
• Chain 'H':
  Compound: 30S ribosomal subunit protein S8
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7W7 (0-126)
  Domains in SCOPe 2.08: d2gybh1
• Chain 'I':
  Compound: 30S ribosomal subunit protein S9
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7X3 (0-125)
  Domains in SCOPe 2.08: d2gybi1
• Chain 'J':
  Compound: 30S ribosomal subunit protein S10
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R5 (0-95)
• Chain 'K':
  Compound: 30S ribosomal subunit protein S11
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7R9 (0-115)
• Chain 'L':
  Compound: 30S ribosomal subunit protein S12
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S3 (0-100)
• Chain 'M':
  Compound: 30S ribosomal subunit protein S13
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7S9 (0-114)
  Domains in SCOPe 2.08: d2gybm1
• Chain 'N':
  Compound: 30S ribosomal subunit protein S14
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG59 (0-60)
• Chain 'O':
  Compound: 30S ribosomal subunit protein S15
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ADZ4 (0-85)
• Chain 'P':
  Compound: 30S ribosomal subunit protein S16
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T3 (0-77)
  Domains in SCOPe 2.08: d2gybp1
• Chain 'Q':
  Compound: 30S ribosomal subunit protein S17
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AG63 (0-78)
  Domains in SCOPe 2.08: d2gybq1
• Chain 'R':
  Compound: 30S ribosomal subunit protein S18
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7T7 (0-68)
• Chain 'S':
  Compound: 30S ribosomal subunit protein S19
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U3 (0-86)
  Domains in SCOPe 2.08: d2gybs1
• Chain 'T':
  Compound: 30S ribosomal subunit protein S20
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7U7 (0-82)
  Domains in SCOPe 2.08: d2gybt1
• Chain 'U':
  Compound: tRNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'V':
  Compound: tRNA
  Species: Escherichia coli [TaxId:562]
  
• Chain 'W':
  Compound: tRNA
  Species: Escherichia coli [TaxId:562]
  

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybB (B:)
  mrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkg
  kilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgt
  fdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfa
  ivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybD (D:)
  rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
  riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
  imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
  krkpersdlsadinehlivelysk
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybH (H:)
  mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
  lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
  geiicyv
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybI (I:)
  qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
  itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
  pqfskr
  

  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybM (M:)
  ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
  kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpi
  

  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybP (P:)
  mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
  vgqgatisdrvaalikev
  

  
  
• Chain 'Q':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybQ (Q:)
  rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
  plsktkswtlvrvvekavl
  

  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybS (S:)
  prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
  vtdemvghklgefaptrtyrghaadkk
  

  
  
• Chain 'T':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gybT (T:)
  ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
  glihknkaarhkanltaqinkla
  

  
  
• Chain 'U':
  No sequence available.
  
  
• Chain 'V':
  No sequence available.
  
  
• Chain 'W':
  No sequence available.