PDB entry 2gyb

View 2gyb on RCSB PDB site
Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
Class: ribosome
Keywords: SecM; nascent chain; signal transduction; RNA world; polypeptide exit tunnel; translocation; ribosome; elongation arrest; protein-conducting channel
Deposited on 2006-05-09, released 2006-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 15 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'B':
    Compound: 30S ribosomal subunit protein S2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybb1
  • Chain 'C':
    Compound: 30S ribosomal subunit protein S3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 30S ribosomal subunit protein S4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybd1
  • Chain 'E':
    Compound: 30S ribosomal subunit protein S5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 30S ribosomal subunit protein S6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 30S ribosomal subunit protein S7
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 30S ribosomal subunit protein S8
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybh1
  • Chain 'I':
    Compound: 30S ribosomal subunit protein S9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybi1
  • Chain 'J':
    Compound: 30S ribosomal subunit protein S10
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 30S ribosomal subunit protein S11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 30S ribosomal subunit protein S12
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 30S ribosomal subunit protein S13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybm1
  • Chain 'N':
    Compound: 30S ribosomal subunit protein S14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 30S ribosomal subunit protein S15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 30S ribosomal subunit protein S16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybp1
  • Chain 'Q':
    Compound: 30S ribosomal subunit protein S17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybq1
  • Chain 'R':
    Compound: 30S ribosomal subunit protein S18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 30S ribosomal subunit protein S19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybs1
  • Chain 'T':
    Compound: 30S ribosomal subunit protein S20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gybt1
  • Chain 'U':
    Compound: tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'V':
    Compound: tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'W':
    Compound: tRNA
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybB (B:)
    mrdmlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkg
    kilfvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgt
    fdkltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfa
    ivdtnsdpdgvdfvipgnddairavtlylgavaatvregrsqdlasqaeesfveae
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybD (D:)
    rylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkvr
    riygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshka
    imvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegtf
    krkpersdlsadinehlivelysk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybH (H:)
    mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
    lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
    geiicyv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybI (I:)
    qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
    itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
    pqfskr
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybM (M:)
    ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
    kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkpi
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybP (P:)
    mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
    vgqgatisdrvaalikev
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybQ (Q:)
    rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr
    plsktkswtlvrvvekavl
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybS (S:)
    prslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvf
    vtdemvghklgefaptrtyrghaadkk
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gybT (T:)
    ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
    glihknkaarhkanltaqinkla
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.