Lineage for d2gybi1 (2gyb I:4-129)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. Protein Ribosomal protein S9 [54218] (2 species)
  7. Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. Domain d2gybi1: 2gyb I:4-129 [145256]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
    protein/RNA complex
    protein/RNA complex

Details for d2gybi1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (I:) 30S ribosomal subunit protein S9

SCOPe Domain Sequences for d2gybi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybi1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
qyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldly
itvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarrr
pqfskr

SCOPe Domain Coordinates for d2gybi1 are not available.

Timeline for d2gybi1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gybb1, d2gybd1, d2gybh1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1