Lineage for d2gybh1 (2gyb H:3-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978274Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
    Uniprot P02361
  8. 2978283Domain d2gybh1: 2gyb H:3-128 [135844]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybs1, d2gybt1
    protein/RNA complex
    protein/RNA complex

Details for d2gybh1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (H:) 30S ribosomal subunit protein S8

SCOPe Domain Sequences for d2gybh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybh1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyv

SCOPe Domain Coordinates for d2gybh1:

Click to download the PDB-style file with coordinates for d2gybh1.
(The format of our PDB-style files is described here.)

Timeline for d2gybh1: