Lineage for d2gybp1 (2gyb P:1-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942074Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2942075Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2942076Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2942077Protein Ribosomal protein S16 [54567] (3 species)
  7. 2942080Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 2942105Domain d2gybp1: 2gyb P:1-78 [145258]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybq1, d2gybs1, d2gybt1
    protein/RNA complex
    protein/RNA complex

Details for d2gybp1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (P:) 30S ribosomal subunit protein S16

SCOPe Domain Sequences for d2gybp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybp1 d.27.1.1 (P:1-78) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikev

SCOPe Domain Coordinates for d2gybp1:

Click to download the PDB-style file with coordinates for d2gybp1.
(The format of our PDB-style files is described here.)

Timeline for d2gybp1: