SCOPe 2.07: Structural Classification of Proteins

PDB entry 2fy8

View 2fy8 on RCSB PDB site
Description: Crystal structure of MthK rck domain in its ligand-free gating-ring form
Class: transport protein
Keywords: Transport, Ionic channel, Alternative initiation, Transmembrane, Ion transport, Potassium, Potassium transport, Membrane, gating ring, closed conformation, partially open conformation, transition state, TRANSPORT PROTEIN
Deposited on 2006-02-07, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8a1, d2fy8a2
Chain 'B':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8b1, d2fy8b2
Chain 'C':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8c1, d2fy8c2
Chain 'D':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8d1, d2fy8d2
Chain 'E':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8e1, d2fy8e2
Chain 'F':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8f1, d2fy8f2
Chain 'G':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8g1, d2fy8g2
Chain 'H':
Compound: Calcium-gated potassium channel mthK
Species: Methanothermobacter thermautotrophicus [TaxId:145262]
Gene: mthK
Database cross-references and differences (RAF-indexed):
- Uniprot O27564 (Start-229)
  - engineered (77)
Domains in SCOPe 2.07: d2fy8h1, d2fy8h2
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2fy8A (A:)
mglidvaksrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptr
vsdlekanvrgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagad
qvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadih
dvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyisa