Lineage for d2fy8h1 (2fy8 H:115-244)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453998Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2454021Protein Potassium channel-related protein MthK [75122] (1 species)
  7. 2454022Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries)
  8. 2454034Domain d2fy8h1: 2fy8 H:115-244 [134359]
    Other proteins in same PDB: d2fy8a2, d2fy8b2, d2fy8c2, d2fy8d2, d2fy8e2, d2fy8f2, d2fy8g2, d2fy8h2
    automated match to d2aema1

Details for d2fy8h1

PDB Entry: 2fy8 (more details), 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form
PDB Compounds: (H:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2fy8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fy8h1 c.2.1.9 (H:115-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
srhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekan
vrgaravivnlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvi
sgrlmsrsid

SCOPe Domain Coordinates for d2fy8h1:

Click to download the PDB-style file with coordinates for d2fy8h1.
(The format of our PDB-style files is described here.)

Timeline for d2fy8h1: