SCOPe 2.07: Domain d2fy8h2: 2fy8 H:245-336

Lineage for d2fy8h2 (2fy8 H:245-336)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries)

8. Domain d2fy8h2: 2fy8 H:245-336 [134360]
   Other proteins in same PDB: d2fy8a1, d2fy8b1, d2fy8c1, d2fy8d1, d2fy8e1, d2fy8f1, d2fy8g1, d2fy8h1
   automated match to d2aema2

Details for d2fy8h2

PDB Entry: 2fy8, 2.79 Å

PDB Description: crystal structure of mthk rck domain in its ligand-free gating-ring form

PDB Compounds: (H:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d2fy8h2:

Sequence; same for both SEQRES and ATOM records:

>d2fy8h2 d.286.1.1 (H:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

Timeline for d2fy8h2:

• d2fy8h2 first appeared in SCOP 1.73
  
• d2fy8h2 appears in SCOPe 2.06
  
• d2fy8h2 appears in the current release, SCOPe 2.08