PDB entry 1y3a

View 1y3a on RCSB PDB site
Description: Structure of G-Alpha-I1 bound to a GDP-selective peptide provides insight into guanine nucleotide exchange
Class: signaling protein
Keywords: protein-peptide complex, signaling protein
Deposited on 2004-11-24, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3aa1, d1y3aa2
  • Chain 'B':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3ab1, d1y3ab2
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3ac1, d1y3ac2
  • Chain 'D':
    Compound: Guanine nucleotide-binding protein G(i), alpha-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: GNAI1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y3ad1, d1y3ad2
  • Chain 'E':
    Compound: KB752 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y3A (0-End)
  • Chain 'F':
    Compound: KB752 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y3A (0-End)
  • Chain 'G':
    Compound: KB752 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y3A (0-End)
  • Chain 'H':
    Compound: KB752 peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y3A (0-End)
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y3aA (A:)
    dgekaarevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaii
    ramgrlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsre
    yqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqr
    serkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsii
    lflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftc
    atdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3aA (A:)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdsaraddarqlfvlamtaelagvikrlwkdsgvqacfnrsreyqlndsaayylndld
    riaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegvta
    iifcvalsdydlvmnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikkspltic
    ypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y3aB (B:)
    dgekaarevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaii
    ramgrlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsre
    yqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqr
    serkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsii
    lflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftc
    atdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3aB (B:)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdsaraddarqlfvlaggfmtaelagvikrlwkdsgvqacfnrsreyqlndsaayyln
    dldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfeg
    vtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdlfeek
    ikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfd
    avtdvii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y3aC (C:)
    dgekaarevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaii
    ramgrlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsre
    yqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqr
    serkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsii
    lflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftc
    atdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3aC (C:)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdsaraddarqlfvlamtaelagvikrlwkdsgvqacfnrsreyqlndsaayylndld
    riaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegvta
    iifcvalsdydlvmnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikkspltic
    ypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdvii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y3aD (D:)
    dgekaarevkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaii
    ramgrlkidfgdsaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsre
    yqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqr
    serkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsii
    lflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftc
    atdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y3aD (D:)
    vkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrlki
    dfgdsaraddarqlfvlamtaelagvikrlwkdsgvqacfnrsreyqlndsaayylndld
    riaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkwihcfegvta
    iifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekikk
    splticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavt
    dvii
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.