SCOPe 2.08: Domain d1y3ad2: 1y3a D:34-60,D:182-344

Lineage for d1y3ad2 (1y3a D:34-60,D:182-344)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)

8. Domain d1y3ad2: 1y3a D:34-60,D:182-344 [122589]
   Other proteins in same PDB: d1y3aa1, d1y3ab1, d1y3ac1, d1y3ad1
   automatically matched to d1kjya2
   complexed with gdp
   has additional subdomain(s) that are not in the common domain

Details for d1y3ad2

PDB Entry: 1y3a, 2.5 Å

PDB Description: structure of g-alpha-i1 bound to a gdp-selective peptide provides insight into guanine nucleotide exchange

PDB Compounds: (D:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1y3ad2:

Sequence; same for both SEQRES and ATOM records:

>d1y3ad2 c.37.1.8 (D:34-60,D:182-344) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvii

Timeline for d1y3ad2:

• d1y3ad2 first appeared in SCOP 1.73
  
• d1y3ad2 appears in SCOPe 2.07