![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries) |
![]() | Domain d1y3ac1: 1y3a C:61-181 [122586] Other proteins in same PDB: d1y3aa2, d1y3ab2, d1y3ac2, d1y3ad2 automatically matched to d1kjya1 complexed with gdp |
PDB Entry: 1y3a (more details), 2.5 Å
SCOPe Domain Sequences for d1y3ac1:
Sequence, based on SEQRES records: (download)
>d1y3ac1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
>d1y3ac1 a.66.1.1 (C:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
Timeline for d1y3ac1: