SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1y3ac2 (1y3a C:34-60,C:182-344)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111040Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2111065Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)
  8. 2111074Domain d1y3ac2: 1y3a C:34-60,C:182-344 [122587]
    Other proteins in same PDB: d1y3aa1, d1y3ab1, d1y3ac1, d1y3ad1
    automatically matched to d1kjya2
    complexed with gdp

Details for d1y3ac2

PDB Entry: 1y3a (more details), 2.5 Å

PDB Description: Structure of G-Alpha-I1 bound to a GDP-selective peptide provides insight into guanine nucleotide exchange
PDB Compounds: (C:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1y3ac2:

Sequence, based on SEQRES records: (download)

>d1y3ac2 c.37.1.8 (C:34-60,C:182-344) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkdl
feekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvq
fvfdavtdvii

Sequence, based on observed residues (ATOM records): (download)

>d1y3ac2 c.37.1.8 (C:34-60,C:182-344) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
vkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwih
cfegvtaiifcvalsdydlvmnrmhesmklfdsicnnkwftdtsiilflnkkdlfeekik
ksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknvqfvfdav
tdvii

SCOPe Domain Coordinates for d1y3ac2:

Click to download the PDB-style file with coordinates for d1y3ac2.
(The format of our PDB-style files is described here.)

Timeline for d1y3ac2: