PDB entry 1xe7

View 1xe7 on RCSB PDB site
Description: Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
Class: structural genomics, unknown function
Keywords: jelly roll motif, cupin superfamily, structural genomics, YML079wp, S. cerevisiae, UNKNOWN FUNCTION
Deposited on 2004-09-09, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YML079w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03629 (Start-200)
      • expression tag (201)
    Domains in SCOPe 2.07: d1xe7a1, d1xe7a2
  • Chain 'B':
    Compound: Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YML079w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03629 (Start-200)
      • expression tag (201)
    Domains in SCOPe 2.07: d1xe7b1, d1xe7b2
  • Chain 'C':
    Compound: Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YML079w
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03629 (Start-200)
      • expression tag (201-202)
    Domains in SCOPe 2.07: d1xe7c1, d1xe7c2
  • Heterogens: GUN, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xe7A (A:)
    msanvqeaanaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmev
    ekpvnggsgntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdg
    qvksfkvgfdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflk
    gedelkhlvgpekaaelaflahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xe7A (A:)
    anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvmvtr
    nqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngev
    sqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaae
    laflah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xe7B (B:)
    msanvqeaanaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmev
    ekpvnggsgntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdg
    qvksfkvgfdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflk
    gedelkhlvgpekaaelaflahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xe7B (B:)
    naaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvntemv
    trnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykng
    evsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpeka
    aelaflah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xe7C (C:)
    msanvqeaanaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmev
    ekpvnggsgntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdg
    qvksfkvgfdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflk
    gedelkhlvgpekaaelaflahh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xe7C (C:)
    anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekemvtrn
    qstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngevs
    qwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaael
    aflahh