SCOPe 2.08: Domain d1xe7b1: 1xe7 B:10-201

Lineage for d1xe7b1 (1xe7 B:10-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.16: YML079-like [117318] (4 proteins)
   Pfam PF06172; DUF985

6. Protein Hypothetical protein YML079W [117319] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
   Uniprot Q03629

8. Domain d1xe7b1: 1xe7 B:10-201 [115214]
   Other proteins in same PDB: d1xe7a2, d1xe7b2, d1xe7c2
   structural genomics target
   complexed with acy, edo, gun

Details for d1xe7b1

PDB Entry: 1xe7, 1.75 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold

PDB Compounds: (B:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe7b1:

Sequence, based on SEQRES records:

>d1xe7b1 b.82.1.16 (B:10-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
naaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggsg
ntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgf
dykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlv
gpekaaelafla

Sequence, based on observed residues (ATOM records):

>d1xe7b1 b.82.1.16 (B:10-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
naaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvntemv
trnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykng
evsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpeka
aelafla

Timeline for d1xe7b1:

• d1xe7b1 first appeared in SCOP 1.71, called d1xe7b_
  
• d1xe7b1 appears in SCOPe 2.07