Lineage for d1xe7a1 (1xe7 A:9-201)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. Protein Hypothetical protein YML079W [117319] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries)
    Uniprot Q03629
  8. Domain d1xe7a1: 1xe7 A:9-201 [115213]
    Other proteins in same PDB: d1xe7a2, d1xe7b2, d1xe7c2
    structural genomics target
    complexed with acy, edo, gun

Details for d1xe7a1

PDB Entry: 1xe7 (more details), 1.7500000000000002 Å

PDB Description: crystal structure of the yml079w protein from saccharomyces cerevisiae reveals a new sequence family of the jelly roll fold
PDB Compounds: (A:) Hypothetical 22.5 kDa protein in TUB1-CPR3 intergenic region

SCOPe Domain Sequences for d1xe7a1:

Sequence, based on SEQRES records: (download)

>d1xe7a1 b.82.1.16 (A:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs
gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg
fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl
vgpekaaelafla

Sequence, based on observed residues (ATOM records): (download)

>d1xe7a1 b.82.1.16 (A:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvmvtr
nqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngev
sqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaae
lafla

SCOPe Domain Coordinates for d1xe7a1 are not available.

Timeline for d1xe7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xe7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1xe7b1, d1xe7b2, d1xe7c1, d1xe7c2