Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.16: YML079-like [117318] (4 proteins) Pfam PF06172; DUF985 |
Protein Hypothetical protein YML079W [117319] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117320] (2 PDB entries) Uniprot Q03629 |
Domain d1xe7c1: 1xe7 C:9-201 [115215] Other proteins in same PDB: d1xe7a2, d1xe7b2, d1xe7c2 structural genomics target complexed with acy, edo, gun |
PDB Entry: 1xe7 (more details), 1.75 Å
SCOPe Domain Sequences for d1xe7c1:
Sequence, based on SEQRES records: (download)
>d1xe7c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekpvnggs gntemvtrnqstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvg fdykngevsqwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhl vgpekaaelafla
>d1xe7c1 b.82.1.16 (C:9-201) Hypothetical protein YML079W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} anaaiepasfvkvpmpeppsslqqlindwqlikhreggyfketdrspytmevekemvtrn qstliyylltpdspigkfhkninriihilqrgkgqyvlvypdgqvksfkvgfdykngevs qwvvpggvfkasfllpneefdngflisevvvpgfdfedhtflkgedelkhlvgpekaael afla
Timeline for d1xe7c1:
View in 3D Domains from other chains: (mouse over for more information) d1xe7a1, d1xe7a2, d1xe7b1, d1xe7b2 |