PDB entry 1wdd

View 1wdd on RCSB PDB site
Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate
Class: lyase
Keywords: Rubisco, Photosynthesis, alpha/beta barrel, N-methylmethionine, Post-translational modification, LYASE
Deposited on 2004-05-13, released 2004-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdda1, d1wdda2
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdde1, d1wdde2
  • Chain 'S':
    Compound: Ribulose bisphosphate carboxylase small chain C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wdds_
  • Chain 'W':
    Compound: Ribulose bisphosphate carboxylase small chain C
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wddw_
  • Heterogens: MG, CAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wddA (A:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wddA (A:)
    vgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvw
    tdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkal
    ralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracy
    eclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceem
    ikravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmh
    frvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrargifftqdwvs
    mpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqa
    rnegrdlaregneiirsackwspelaaaceiwkaikfefepvdkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wddE (E:)
    mspqtetkasvgfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaae
    sstgtwttvwtdgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripptysktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygracyeclrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghyl
    natagtceemikravfarelgvpivmhdyltggftantslahycrdnglllhihramhav
    idrqknhgmhfrvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrar
    gifftqdwvsmpgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaan
    rvaleacvqarnegrdlaregneiirsackwspelaaaceiwkaikfefepvdklds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wddE (E:)
    gfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
    dgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalr
    alrledlripptysktfqgpphgiqverdklnkygrpllgctikpklglsaknygracye
    clrggldftkddenvnsqpfmrwrdrfvfcaeaiyksqaetgeikghylnatagtceemi
    kravfarelgvpivmhdyltggftantslahycrdnglllhihramhavidrqknhgmhf
    rvlakalrmsggdhihagtvvgklegeremtlgfvdllrddfiekdrargifftqdwvsm
    pgvipvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgaaanrvaleacvqar
    negrdlaregneiirsackwspelaaaceiwkaikfefepvdkl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1wddS (S:)
    mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
    ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
    gceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wddS (S:)
    mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
    ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
    gc
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1wddW (W:)
    mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
    ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
    gceesggn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wddW (W:)
    mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
    ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
    gc