SCOPe 2.08: Domain d1wdde2: 1wdd E:12-150

Lineage for d1wdde2 (1wdd E:12-150)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [117976] (5 PDB entries)
   Uniprot P12089

8. Domain d1wdde2: 1wdd E:12-150 [114531]
   Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_
   complexed with cap, gol, mg

Details for d1wdde2

PDB Entry: 1wdd, 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate

PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1wdde2:

Sequence; same for both SEQRES and ATOM records:

>d1wdde2 d.58.9.1 (E:12-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
gfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripptysktfqg

Timeline for d1wdde2:

• d1wdde2 first appeared in SCOP 1.71
  
• d1wdde2 appears in SCOPe 2.07