Lineage for d1wdde2 (1wdd E:12-150)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. Species Rice (Oryza sativa) [TaxId:4530] [117976] (5 PDB entries)
    Uniprot P12089
  8. Domain d1wdde2: 1wdd E:12-150 [114531]
    Other proteins in same PDB: d1wdda1, d1wdde1, d1wdds_, d1wddw_
    complexed with cap, gol, mg

Details for d1wdde2

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d1wdde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdde2 d.58.9.1 (E:12-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
gfkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripptysktfqg

SCOPe Domain Coordinates for d1wdde2 are not available.

Timeline for d1wdde2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wdde1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wdda1, d1wdda2, d1wdds_, d1wddw_