Lineage for d1wddw_ (1wdd W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957672Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2957751Species Rice (Oryza sativa) [TaxId:4530] [118017] (1 PDB entry)
    Uniprot P18567
  8. 2957753Domain d1wddw_: 1wdd W: [114533]
    Other proteins in same PDB: d1wdda1, d1wdda2, d1wdde1, d1wdde2
    complexed with cap, gol, mg

Details for d1wddw_

PDB Entry: 1wdd (more details), 1.35 Å

PDB Description: Crystal Structure of Activated Rice Rubisco Complexed with 2-Carboxyarabinitol-1,5-bisphosphate
PDB Compounds: (W:) Ribulose bisphosphate carboxylase small chain C

SCOPe Domain Sequences for d1wddw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wddw_ d.73.1.1 (W:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
gc

SCOPe Domain Coordinates for d1wddw_:

Click to download the PDB-style file with coordinates for d1wddw_.
(The format of our PDB-style files is described here.)

Timeline for d1wddw_: