![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species) |
![]() | Species Rice (Oryza sativa) [TaxId:4530] [118017] (1 PDB entry) Uniprot P18567 |
![]() | Domain d1wddw_: 1wdd W: [114533] Other proteins in same PDB: d1wdda1, d1wdda2, d1wdde1, d1wdde2 complexed with cap, gol, mg |
PDB Entry: 1wdd (more details), 1.35 Å
SCOPe Domain Sequences for d1wddw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wddw_ d.73.1.1 (W:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp gc
Timeline for d1wddw_: