PDB entry 1sig

View 1sig on RCSB PDB site
Description: crystal structure of a sigma70 subunit fragment from escherichia coli rna polymerase
Deposited on 1997-02-18, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sig__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1sig_ (-)
    megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvdpnaee
    dlaptathvgselsqedldddededeedgdddsadddnsidpelarekfaelraqyvvtr
    dtikakgrshataqeeilklsevfkqfrlvpkqfdylvnsmrvmmdrvrtqerlimklcv
    eqckmpkknfitlftgnetsdtwfnaaiamnkpwseklhdvseevhralqklqqieeetg
    ltieqvkdinrrmsigeakarrakkemveanlrlvisiakkytnrglqfldliqegnigl
    mkavdkfeyrrgykfstyatwwirqaitrsiadq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sig_ (-)
    megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvddlapt
    athvgselsqedldidpelarekfaelraqyvvtrdtikahataqeeilklsevfkqfrl
    vpkqfdylvnsmrvmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaia
    mnkpwseklhdvseevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemve
    anlrlvisiakkytnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitr
    siadq