Lineage for d1sig__ (1sig -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5960Fold a.112: sigma70 subunit fragment from RNA polymerase [48328] (1 superfamily)
  4. 5961Superfamily a.112.1: sigma70 subunit fragment from RNA polymerase [48329] (1 family) (S)
  5. 5962Family a.112.1.1: sigma70 subunit fragment from RNA polymerase [48330] (1 protein)
  6. 5963Protein sigma70 subunit fragment from RNA polymerase [48331] (1 species)
  7. 5964Species Escherichia coli [TaxId:562] [48332] (1 PDB entry)
  8. 5965Domain d1sig__: 1sig - [19068]

Details for d1sig__

PDB Entry: 1sig (more details), 2.6 Å

PDB Description: crystal structure of a sigma70 subunit fragment from escherichia coli rna polymerase

SCOP Domain Sequences for d1sig__:

Sequence, based on SEQRES records: (download)

>d1sig__ a.112.1.1 (-) sigma70 subunit fragment from RNA polymerase {Escherichia coli}
megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvdpnaee
dlaptathvgselsqedldddededeedgdddsadddnsidpelarekfaelraqyvvtr
dtikakgrshataqeeilklsevfkqfrlvpkqfdylvnsmrvmmdrvrtqerlimklcv
eqckmpkknfitlftgnetsdtwfnaaiamnkpwseklhdvseevhralqklqqieeetg
ltieqvkdinrrmsigeakarrakkemveanlrlvisiakkytnrglqfldliqegnigl
mkavdkfeyrrgykfstyatwwirqaitrsiadq

Sequence, based on observed residues (ATOM records): (download)

>d1sig__ a.112.1.1 (-) sigma70 subunit fragment from RNA polymerase {Escherichia coli}
megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvddlapt
athvgselsqedldidpelarekfaelraqyvvtrdtikahataqeeilklsevfkqfrl
vpkqfdylvnsmrvmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaia
mnkpwseklhdvseevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemve
anlrlvisiakkytnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitr
siadq

SCOP Domain Coordinates for d1sig__:

Click to download the PDB-style file with coordinates for d1sig__.
(The format of our PDB-style files is described here.)

Timeline for d1sig__: