PDB entry 1rcf

View 1rcf on RCSB PDB site
Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution
Deposited on 1994-10-31, released 1995-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.4 Å
R-factor: 0.139
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rcf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcf_ (-)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl