Lineage for d1rcf__ (1rcf -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21933Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 21934Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 21935Protein Flavodoxin [52220] (6 species)
  7. 21936Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (5 PDB entries)
  8. 21937Domain d1rcf__: 1rcf - [31170]

Details for d1rcf__

PDB Entry: 1rcf (more details), 1.4 Å

PDB Description: structure of the trigonal form of recombinant oxidized flavodoxin from anabaena 7120 at 1.40 angstroms resolution

SCOP Domain Sequences for d1rcf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcf__ c.23.5.1 (-) Flavodoxin {Anabaena, pcc 7119 and 7120}
skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1rcf__:

Click to download the PDB-style file with coordinates for d1rcf__.
(The format of our PDB-style files is described here.)

Timeline for d1rcf__: