PDB entry 1qbe

View 1qbe on RCSB PDB site
Description: bacteriophage q beta capsid
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.304
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qbea_
  • Chain 'B':
    Domains in SCOP 1.55: d1qbeb_
  • Chain 'C':
    Domains in SCOP 1.55: d1qbec_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qbeA (A:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbeA (A:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
    vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
    pay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbeB (B:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qbeC (C:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbeC (C:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
    vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
    pay