Lineage for d1qbea_ (1qbe A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34001Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 34002Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 34003Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 34120Protein Qbeta coat protein [55413] (1 species)
  7. 34121Species Bacteriophage Qbeta [TaxId:39803] [55414] (1 PDB entry)
  8. 34122Domain d1qbea_: 1qbe A: [40138]

Details for d1qbea_

PDB Entry: 1qbe (more details), 3.5 Å

PDB Description: bacteriophage q beta capsid

SCOP Domain Sequences for d1qbea_:

Sequence, based on SEQRES records: (download)

>d1qbea_ d.85.1.1 (A:) Qbeta coat protein {Bacteriophage Qbeta}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
lidaidqlnpay

Sequence, based on observed residues (ATOM records): (download)

>d1qbea_ d.85.1.1 (A:) Qbeta coat protein {Bacteriophage Qbeta}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
pay

SCOP Domain Coordinates for d1qbea_:

Click to download the PDB-style file with coordinates for d1qbea_.
(The format of our PDB-style files is described here.)

Timeline for d1qbea_: