PDB entry 1qam

View 1qam on RCSB PDB site
Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
Deposited on 1999-03-25, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qama_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qamA (A:)
qnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktte
nklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylivey
gfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdkq
kynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk