Lineage for d1qama_ (1qam A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) 
Family c.66.1.9: RNA methylases [53360] (2 proteins) 
Protein rRNA methyltransferase [53363] (2 species) Species Bacillus subtilis, Ermc' [TaxId:1423] [53365] (5 PDB entries) 
Domain d1qama_: 1qam A: [34220]
Details for d1qama_
PDB Entry: 1qam (more details), 2.2 Å
PDB Description: the structure of the rrna methyltransferase ermc': implications for the reaction mechanism
SCOP Domain Sequences for d1qama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qama_ c.66.1.9 (A:) rRNA methyltransferase {Bacillus subtilis, Ermc'}
qnfitskhnidkimtnirlnehdnifeigsgkghftlelvqrcnfvtaieidhklcktte
nklvdhdnfqvlnkdilqfkfpknqsykifgnipynistdiirkivfdsiadeiylivey
gfakrllntkrslalflmaevdisilsmvpreyfhpkpkvnsslirlnrkksrishkdkq
kynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk
SCOP Domain Coordinates for d1qama_:
Click to download the PDB-style file with coordinates for d1qama_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qama_:
- d1qama_ appears in SCOP 1.57
- d1qama_ appears in the current release, SCOPe 2.08
View in 3D