PDB entry 1q6w

View 1q6w on RCSB PDB site
Description: X-Ray structure of Monoamine oxidase regulatory protein from Archaeoglobus fulgius
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, NYSGXRC T805, Hot dog fold, originally observed for the beta-hydroxydecanoyl thiol ester dehydrase, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2003-08-14, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.242
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wa_
  • Chain 'B':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wb_
  • Chain 'C':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wc_
  • Chain 'D':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wd_
  • Chain 'E':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6we_
  • Chain 'F':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wf_
  • Chain 'G':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wg_
  • Chain 'H':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wh_
  • Chain 'I':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wi_
  • Chain 'J':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wj_
  • Chain 'K':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wk_
  • Chain 'L':
    Compound: monoamine oxidase regulatory protein, putative
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28346
      • modified residue (68)
      • modified residue (77)
    Domains in SCOPe 2.07: d1q6wl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q6wA (A:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wA (A:)
    arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
    mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
    sgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q6wB (B:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wB (B:)
    arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
    mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
    sgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1q6wC (C:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wC (C:)
    imarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpia
    qgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfd
    eksgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1q6wD (D:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wD (D:)
    arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
    mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
    sgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1q6wE (E:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wE (E:)
    arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
    mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
    sgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1q6wF (F:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wF (F:)
    arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
    mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
    sgvvtyklevknqrgelvltalysalirktp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1q6wG (G:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wG (G:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1q6wH (H:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wH (H:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1q6wI (I:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wI (I:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1q6wJ (J:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wJ (J:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1q6wK (K:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wK (K:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1q6wL (L:)
    mdfpriimarnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakkti
    fgkpiaqgmlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevv
    ekqdfdeksgvvtyklevknqrgelvltalysalirktpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q6wL (L:)
    npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
    vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
    vvtyklevknqrgelvltalysalirktp