Lineage for d1q6wk_ (1q6w K:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2511612Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2511613Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2511851Family d.38.1.4: MaoC-like [82636] (6 protein domains)
  6. 2511914Protein Monoamine oxidase regulatory protein [102905] (1 species)
  7. 2511915Species Archaeoglobus fulgidus [TaxId:2234] [102906] (1 PDB entry)
  8. 2511926Domain d1q6wk_: 1q6w K: [96010]
    structural genomics

Details for d1q6wk_

PDB Entry: 1q6w (more details), 2.81 Å

PDB Description: X-Ray structure of Monoamine oxidase regulatory protein from Archaeoglobus fulgius
PDB Compounds: (K:) monoamine oxidase regulatory protein, putative

SCOPe Domain Sequences for d1q6wk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6wk_ d.38.1.4 (K:) Monoamine oxidase regulatory protein {Archaeoglobus fulgidus [TaxId: 2234]}
npiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqgml
vlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdeksg
vvtyklevknqrgelvltalysalirktp

SCOPe Domain Coordinates for d1q6wk_:

Click to download the PDB-style file with coordinates for d1q6wk_.
(The format of our PDB-style files is described here.)

Timeline for d1q6wk_: