Lineage for d1q6wf_ (1q6w F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943777Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2943840Protein Monoamine oxidase regulatory protein [102905] (1 species)
  7. 2943841Species Archaeoglobus fulgidus [TaxId:2234] [102906] (1 PDB entry)
  8. 2943847Domain d1q6wf_: 1q6w F: [96005]
    structural genomics

Details for d1q6wf_

PDB Entry: 1q6w (more details), 2.81 Å

PDB Description: x-ray structure of monoamine oxidase regulatory protein from archaeoglobus fulgius
PDB Compounds: (F:) monoamine oxidase regulatory protein, putative

SCOPe Domain Sequences for d1q6wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6wf_ d.38.1.4 (F:) Monoamine oxidase regulatory protein {Archaeoglobus fulgidus [TaxId: 2234]}
arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg
mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek
sgvvtyklevknqrgelvltalysalirktp

SCOPe Domain Coordinates for d1q6wf_:

Click to download the PDB-style file with coordinates for d1q6wf_.
(The format of our PDB-style files is described here.)

Timeline for d1q6wf_: