![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.4: MaoC-like [82636] (6 proteins) |
![]() | Protein Monoamine oxidase regulatory protein [102905] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [102906] (1 PDB entry) |
![]() | Domain d1q6wd_: 1q6w D: [96003] structural genomics |
PDB Entry: 1q6w (more details), 2.81 Å
SCOPe Domain Sequences for d1q6wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6wd_ d.38.1.4 (D:) Monoamine oxidase regulatory protein {Archaeoglobus fulgidus [TaxId: 2234]} arnpiyfesiqigekieglprtvtetdiwtfayltadffplhtdvefakktifgkpiaqg mlvlsialgmvdqvilsnydvssviaffgikdvrflrpvfigdtiaasaevvekqdfdek sgvvtyklevknqrgelvltalysalirktp
Timeline for d1q6wd_: