PDB entry 1pcs

View 1pcs on RCSB PDB site
Description: the 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803
Deposited on 1997-06-17, released 1997-12-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-17, with a file datestamp of 1997-12-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pcs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pcs_ (-)
    anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfdadgvpadtaaklshkg
    llfaagesftstftepgtytyycephrgagmvgkvvve