Lineage for d1pcs__ (1pcs -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11056Species Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId:1148] [49519] (3 PDB entries)
  8. 11057Domain d1pcs__: 1pcs - [22871]

Details for d1pcs__

PDB Entry: 1pcs (more details), 2.15 Å

PDB Description: the 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803

SCOP Domain Sequences for d1pcs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcs__ b.6.1.1 (-) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfdadgvpadtaaklshkg
llfaagesftstftepgtytyycephrgagmvgkvvve

SCOP Domain Coordinates for d1pcs__:

Click to download the PDB-style file with coordinates for d1pcs__.
(The format of our PDB-style files is described here.)

Timeline for d1pcs__: