PDB entry 1odd

View 1odd on RCSB PDB site
Description: ompr c-terminal domain (ompr-c) from escherichia coli
Deposited on 1996-10-31, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1odd__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1odd_ (-)
  aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys
  amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd