Class a: All alpha proteins [46456] (138 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) |
Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) |
Family a.4.6.1: PhoB-like [46895] (2 proteins) |
Protein OmpR [46896] (1 species) |
Species Escherichia coli [TaxId:562] [46897] (2 PDB entries) |
Domain d1odd__: 1odd - [16232] |
PDB Entry: 1odd (more details), 2.2 Å
SCOP Domain Sequences for d1odd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1odd__ a.4.6.1 (-) OmpR {Escherichia coli} aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd
Timeline for d1odd__: