Lineage for d1odd__ (1odd -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1689Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 1690Family a.4.6.1: PhoB-like [46895] (2 proteins)
  6. 1691Protein OmpR [46896] (1 species)
  7. 1692Species Escherichia coli [TaxId:562] [46897] (2 PDB entries)
  8. 1694Domain d1odd__: 1odd - [16232]

Details for d1odd__

PDB Entry: 1odd (more details), 2.2 Å

PDB Description: ompr c-terminal domain (ompr-c) from escherichia coli

SCOP Domain Sequences for d1odd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1odd__ a.4.6.1 (-) OmpR {Escherichia coli}
aviafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreys
amersidvqisrlrrmveedpahpryiqtvwglgyvfvpd

SCOP Domain Coordinates for d1odd__:

Click to download the PDB-style file with coordinates for d1odd__.
(The format of our PDB-style files is described here.)

Timeline for d1odd__: