PDB entry 1n32

View 1n32 on RCSB PDB site
Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Deposited on 2002-10-25, released 2002-11-29
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-29, with a file datestamp of 2002-11-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.227
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.63: d1n32b_
  • Chain 'C':
    Domains in SCOP 1.63: d1n32c1, d1n32c2
  • Chain 'D':
    Domains in SCOP 1.63: d1n32d_
  • Chain 'E':
    Domains in SCOP 1.63: d1n32e1, d1n32e2
  • Chain 'F':
    Domains in SCOP 1.63: d1n32f_
  • Chain 'G':
    Domains in SCOP 1.63: d1n32g_
  • Chain 'H':
    Domains in SCOP 1.63: d1n32h_
  • Chain 'I':
    Domains in SCOP 1.63: d1n32i_
  • Chain 'J':
    Domains in SCOP 1.63: d1n32j_
  • Chain 'K':
    Domains in SCOP 1.63: d1n32k_
  • Chain 'L':
    Domains in SCOP 1.63: d1n32l_
  • Chain 'M':
    Domains in SCOP 1.63: d1n32m_
  • Chain 'N':
    Domains in SCOP 1.63: d1n32n_
  • Chain 'O':
    Domains in SCOP 1.63: d1n32o_
  • Chain 'P':
    Domains in SCOP 1.63: d1n32p_
  • Chain 'Q':
    Domains in SCOP 1.63: d1n32q_
  • Chain 'R':
    Domains in SCOP 1.63: d1n32r_
  • Chain 'S':
    Domains in SCOP 1.63: d1n32s_
  • Chain 'T':
    Domains in SCOP 1.63: d1n32t_
  • Chain 'V':
    Domains in SCOP 1.63: d1n32v_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32B (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32C (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32D (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32E (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32F (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32G (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32H (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32I (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32J (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32K (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32L (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32M (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvag
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32N (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32O (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32P (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32Q (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32R (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32S (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32T (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n32V (V:)
    gkgdrrtrrgkiwrgtygkyrprk