SCOP 1.63: Domain d1n32c1: 1n32 C:2-106

Lineage for d1n32c1 (1n32 C:2-106)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (6 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54817] (14 PDB entries)

8. Domain d1n32c1: 1n32 C:2-106 [79870]
   Other proteins in same PDB: d1n32b_, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32o_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_
   complexed with mg, par, psu, zn

Details for d1n32c1

PDB Entry: 1n32, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin

SCOP Domain Sequences for d1n32c1:

Sequence; same for both SEQRES and ATOM records:

>d1n32c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev

Timeline for d1n32c1:

• d1n32c1 is new in SCOP 1.63
  
• d1n32c1 appears in SCOP 1.65
  
• d1n32c1 appears in the current release, SCOPe 2.08