Class a: All alpha proteins [46456] (171 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (2 species) |
Species Thermus thermophilus [TaxId:274] [47067] (18 PDB entries) |
Domain d1n32o_: 1n32 O: [79884] Other proteins in same PDB: d1n32b_, d1n32c1, d1n32c2, d1n32d_, d1n32e1, d1n32e2, d1n32f_, d1n32g_, d1n32h_, d1n32i_, d1n32j_, d1n32k_, d1n32l_, d1n32m_, d1n32n_, d1n32p_, d1n32q_, d1n32r_, d1n32s_, d1n32t_, d1n32v_ complexed with mg, par, psu, zn |
PDB Entry: 1n32 (more details), 3 Å
SCOP Domain Sequences for d1n32o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n32o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1n32o_: