PDB entry 1mra

View 1mra on RCSB PDB site
Description:
Deposited on 1996-03-12, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1mra_1, d1mra_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mra_ (-)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigacrlampnamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv