Lineage for d1mra_2 (1mra 3-132)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (6 proteins) 
Protein Mandelate racemase [54838] (1 species) Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries) 
Domain d1mra_2: 1mra 3-132 [38894]
Other proteins in same PDB: d1mra_1
Details for d1mra_2
PDB Entry: 1mra (more details), 2.1 Å
PDB Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
SCOP Domain Sequences for d1mra_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mra_2 d.54.1.1 (3-132) Mandelate racemase {Pseudomonas putida}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar
SCOP Domain Coordinates for d1mra_2:
Click to download the PDB-style file with coordinates for d1mra_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mra_2:
- d1mra_2 appears in SCOP 1.57
- d1mra_2 appears in the current release, SCOPe 2.08, called d1mraa2
View in 3D
