PDB entry 1iba

View 1iba on RCSB PDB site
Description: glucose permease (domain iib), nmr, 11 structures
Deposited on 1996-03-23, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: NMR11
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1iba__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iba_ (-)
    mapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaifg
    tksdnlktemdeyirnfg