PDB entry 1e6v

View 1e6v on RCSB PDB site
Description: Methyl-coenzyme M reductase from Methanopyrus kandleri
Class: oxidoreductase
Keywords: biological methanogenesis, ni-enzyme, oxidoreductase, ni enzyme
Deposited on 2000-08-23, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-coenzyme m reductase I alpha subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6va1, d1e6va2
  • Chain 'B':
    Compound: methyl-coenzyme m reductase I beta subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q49601
      • cloning artifact (48)
      • cloning artifact (97)
      • cloning artifact (219)
    Domains in SCOPe 2.07: d1e6vb1, d1e6vb2
  • Chain 'C':
    Compound: methyl-coenzyme m reductase I gamma subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6vc_
  • Chain 'D':
    Compound: methyl-coenzyme m reductase I alpha subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6vd1, d1e6vd2
  • Chain 'E':
    Compound: methyl-coenzyme m reductase I beta subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q49601
      • cloning artifact (48)
      • cloning artifact (97)
      • cloning artifact (219)
    Domains in SCOPe 2.07: d1e6ve1, d1e6ve2
  • Chain 'F':
    Compound: methyl-coenzyme m reductase I gamma subunit
    Species: Methanopyrus kandleri [TaxId:2320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e6vf_
  • Heterogens: F43, TP7, COM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6vA (A:)
    mssaeeklfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphyn
    pdigvplgqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvle
    rrlgkevtpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeid
    dkflidieklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsfic
    aykiaageaavsdfafaskhaevinmgemlparrargenepggvpfgvladcvqtmrkyp
    ddpakvaleviaagamlydqiwlgsymsggvgftqyatavypdnilddyvyygleyvedk
    ygiaeaepsmdvvkdvatevtlygleqyerypaamethfggsqraavcaaaagcstafat
    ghaqaglngwylsqilhkegqgrlgfygyalqdqcgaanslsvrsdeglplelrgpnypn
    yamnvghlgeyagivqaahaargdafcvhpvikvafadenlvfdfteprkefakgalref
    epagerdlivpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vA (A:)
    lfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphynpdigvpl
    gqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvlerrlgkev
    tpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeiddkflidi
    eklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsficaykiaag
    eaavsdfafaskhaevinmgemlparrargenepggvpfgvladcvqtmrkypddpakva
    leviaagamlydqiwlgsymsggvgftqyatavypdnilddyvyygleyvedkygiaeae
    psmdvvkdvatevtlygleqyerypaamethfggsqraavcaaaagcstafatghaqagl
    ngwylsqilhkegqgrlgfygyalqdqcgaanslsvrsdeglplelrgpnypnyamnvgh
    lgeyagivqaahaargdafcvhpvikvafadenlvfdfteprkefakgalrefepagerd
    livpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e6vB (B:)
    mareakdtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqn
    atvggkgmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpse
    rvkvmadpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasml
    dvpmkqegvgyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhll
    gyayqglnadnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandm
    dlwnayaaaglvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgf
    sffshsiyggggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvf
    geidefrepmkyiteaaaeeakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vB (B:)
    dtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqnatvggk
    gmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpservkvma
    dpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasmldvpmkq
    egvgyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqg
    lnadnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnay
    aaaglvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshs
    iyggggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidef
    repmkyiteaaaeeak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1e6vC (C:)
    maekaqfyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppl
    eemeepecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgs
    lsgrqiievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryr
    lneetgeveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqr
    ihelrtlagyrpeeaegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vC (C:)
    fyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppleemeep
    ecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgslsgrqi
    ievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryrlneetg
    eveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqrihelrt
    lagyrpee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1e6vD (D:)
    mssaeeklfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphyn
    pdigvplgqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvle
    rrlgkevtpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeid
    dkflidieklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsfic
    aykiaageaavsdfafaskhaevinmgemlparrargenepggvpfgvladcvqtmrkyp
    ddpakvaleviaagamlydqiwlgsymsggvgftqyatavypdnilddyvyygleyvedk
    ygiaeaepsmdvvkdvatevtlygleqyerypaamethfggsqraavcaaaagcstafat
    ghaqaglngwylsqilhkegqgrlgfygyalqdqcgaanslsvrsdeglplelrgpnypn
    yamnvghlgeyagivqaahaargdafcvhpvikvafadenlvfdfteprkefakgalref
    epagerdlivpae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vD (D:)
    lfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphynpdigvpl
    gqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvlerrlgkev
    tpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeiddkflidi
    eklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsficaykiaag
    eaavsdfafaskhaevinmgemlparrargenepggvpfgvladcvqtmrkypddpakva
    leviaagamlydqiwlgsymsggvgftqyatavypdnilddyvyygleyvedkygiaeae
    psmdvvkdvatevtlygleqyerypaamethfggsqraavcaaaagcstafatghaqagl
    ngwylsqilhkegqgrlgfygyalqdqcgaanslsvrsdeglplelrgpnypnyamnvgh
    lgeyagivqaahaargdafcvhpvikvafadenlvfdfteprkefakgalrefepagerd
    livpa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1e6vE (E:)
    mareakdtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqn
    atvggkgmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpse
    rvkvmadpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasml
    dvpmkqegvgyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhll
    gyayqglnadnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandm
    dlwnayaaaglvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgf
    sffshsiyggggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvf
    geidefrepmkyiteaaaeeakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vE (E:)
    dtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqnatvggk
    gmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpservkvma
    dpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasmldvpmkq
    egvgyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqg
    lnadnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnay
    aaaglvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshs
    iyggggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidef
    repmkyiteaaaeeak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1e6vF (F:)
    maekaqfyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppl
    eemeepecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgs
    lsgrqiievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryr
    lneetgeveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqr
    ihelrtlagyrpeeaegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6vF (F:)
    fyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppleemeep
    ecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgslsgrqi
    ievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryrlneetg
    eveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqrihelrt
    lagyrpee