Lineage for d1e6vc_ (1e6v C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955027Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2955028Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2955060Species Methanopyrus kandleri [TaxId:2320] [55092] (1 PDB entry)
  8. 2955061Domain d1e6vc_: 1e6v C: [39439]
    Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vb2, d1e6vd1, d1e6vd2, d1e6ve1, d1e6ve2
    complexed with com, f43, tp7

Details for d1e6vc_

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri
PDB Compounds: (C:) methyl-coenzyme m reductase I gamma subunit

SCOPe Domain Sequences for d1e6vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6vc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanopyrus kandleri [TaxId: 2320]}
fyypgetdvaenrrkymnpnyelkklreipdedivrlmghrepgeeypsvhppleemeep
ecpirelveptegakagdriryiqftdsvyfapihpyirarmymwryrgvdtgslsgrqi
ievrerdlekiakelleteifdparsgvrgatvhghalrldenglmlhalrryrlneetg
eveyvkdqvgieldepipvgapadeddlkerttiyridgtpyredeellqvvqrihelrt
lagyrpee

SCOPe Domain Coordinates for d1e6vc_:

Click to download the PDB-style file with coordinates for d1e6vc_.
(The format of our PDB-style files is described here.)

Timeline for d1e6vc_: