Lineage for d1e6va1 (1e6v A:273-552)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719658Protein Alpha chain [48083] (3 species)
  7. 2719682Species Methanopyrus kandleri [TaxId:2320] [48085] (1 PDB entry)
  8. 2719683Domain d1e6va1: 1e6v A:273-552 [18527]
    Other proteins in same PDB: d1e6va2, d1e6vb1, d1e6vb2, d1e6vc_, d1e6vd2, d1e6ve1, d1e6ve2, d1e6vf_
    complexed with com, f43, tp7

Details for d1e6va1

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri
PDB Compounds: (A:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1e6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6va1 a.89.1.1 (A:273-552) Alpha chain {Methanopyrus kandleri [TaxId: 2320]}
rrargenepggvpfgvladcvqtmrkypddpakvaleviaagamlydqiwlgsymsggvg
ftqyatavypdnilddyvyygleyvedkygiaeaepsmdvvkdvatevtlygleqyeryp
aamethfggsqraavcaaaagcstafatghaqaglngwylsqilhkegqgrlgfygyalq
dqcgaanslsvrsdeglplelrgpnypnyamnvghlgeyagivqaahaargdafcvhpvi
kvafadenlvfdfteprkefakgalrefepagerdlivpa

SCOPe Domain Coordinates for d1e6va1:

Click to download the PDB-style file with coordinates for d1e6va1.
(The format of our PDB-style files is described here.)

Timeline for d1e6va1: