SCOPe 2.08: Domain d1e6vd1: 1e6v D:273-552

Lineage for d1e6vd1 (1e6v D:273-552)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [48083] (3 species)

7. Species Methanopyrus kandleri [TaxId:2320] [48085] (1 PDB entry)

8. Domain d1e6vd1: 1e6v D:273-552 [18528]
   Other proteins in same PDB: d1e6va2, d1e6vb1, d1e6vb2, d1e6vc_, d1e6vd2, d1e6ve1, d1e6ve2, d1e6vf_
   complexed with com, f43, tp7

Details for d1e6vd1

PDB Entry: 1e6v, 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1e6vd1:

Sequence; same for both SEQRES and ATOM records:

>d1e6vd1 a.89.1.1 (D:273-552) Alpha chain {Methanopyrus kandleri [TaxId: 2320]}
rrargenepggvpfgvladcvqtmrkypddpakvaleviaagamlydqiwlgsymsggvg
ftqyatavypdnilddyvyygleyvedkygiaeaepsmdvvkdvatevtlygleqyeryp
aamethfggsqraavcaaaagcstafatghaqaglngwylsqilhkegqgrlgfygyalq
dqcgaanslsvrsdeglplelrgpnypnyamnvghlgeyagivqaahaargdafcvhpvi
kvafadenlvfdfteprkefakgalrefepagerdlivpa

Timeline for d1e6vd1:

• d1e6vd1 first appeared (with stable ids) in SCOP 1.55
  
• d1e6vd1 appears in SCOPe 2.07