PDB entry 1d2z

View 1d2z on RCSB PDB site
Description: three-dimensional structure of a complex between the death domains of pelle and tube
Class: apoptosis
Keywords: six-helix bundle, linear array of death domains, plastic interfaces, apoptosis
Deposited on 1999-09-28, released 1999-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death domain of pelle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2za_
  • Chain 'B':
    Compound: death domain of tube
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2zb_
  • Chain 'C':
    Compound: death domain of pelle
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05652 (0-107)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1d2zc1, d1d2zc2
  • Chain 'D':
    Compound: death domain of tube
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d2zd_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d2zA (A:)
    gshmshldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrs
    asneflniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2zA (A:)
    ldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrsasnefl
    niwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d2zB (B:)
    lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
    kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
    saadfvaldflnestparpvdgpgalislelle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d2zB (B:)
    lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
    kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
    saadfvaldflnestparpvdgpgalisle
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2zC (C:)
    gshmshldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrs
    asneflniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d2zD (D:)
    lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
    kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
    saadfvaldflnestparpvdgpgalislelle