SCOPe 2.08: Domain d1d2zd_: 1d2z D:

Lineage for d1d2zd_ (1d2z D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
   Pfam PF00531

6. Protein Tube death domain [48005] (1 species)
   complexed with Pelle death domain

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48006] (1 PDB entry)

8. Domain d1d2zd_: 1d2z D: [18440]
   Other proteins in same PDB: d1d2za_, d1d2zc1, d1d2zc2
   complexed with epe
   has additional insertions and/or extensions that are not grouped together

Details for d1d2zd_

PDB Entry: 1d2z, 2 Å

PDB Description: three-dimensional structure of a complex between the death domains of pelle and tube

PDB Compounds: (D:) death domain of tube

SCOPe Domain Sequences for d1d2zd_:

Sequence; same for both SEQRES and ATOM records:

>d1d2zd_ a.77.1.2 (D:) Tube death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
saadfvaldflnestparpvdgpgalislelle

Timeline for d1d2zd_:

• d1d2zd_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2zd_ appears in SCOPe 2.07