Lineage for d1d2za_ (1d2z A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2718932Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2718965Protein Pelle death domain [48003] (1 species)
  7. 2718966Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48004] (3 PDB entries)
  8. 2718967Domain d1d2za_: 1d2z A: [18437]
    Other proteins in same PDB: d1d2zb_, d1d2zc2, d1d2zd_
    complexed with Tube death domain
    complexed with epe

Details for d1d2za_

PDB Entry: 1d2z (more details), 2 Å

PDB Description: three-dimensional structure of a complex between the death domains of pelle and tube
PDB Compounds: (A:) death domain of pelle

SCOPe Domain Sequences for d1d2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2za_ a.77.1.2 (A:) Pelle death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrsasnefl
niwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyi

SCOPe Domain Coordinates for d1d2za_:

Click to download the PDB-style file with coordinates for d1d2za_.
(The format of our PDB-style files is described here.)

Timeline for d1d2za_: