SCOPe 2.08: Domain d1d2zc1: 1d2z C:26-129

Lineage for d1d2zc1 (1d2z C:26-129)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
   Pfam PF00531

6. Protein Pelle death domain [48003] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48004] (3 PDB entries)

8. Domain d1d2zc1: 1d2z C:26-129 [18438]
   Other proteins in same PDB: d1d2zb_, d1d2zc2, d1d2zd_
   complexed with Tube death domain
   complexed with epe

Details for d1d2zc1

PDB Entry: 1d2z, 2 Å

PDB Description: three-dimensional structure of a complex between the death domains of pelle and tube

PDB Compounds: (C:) death domain of pelle

SCOPe Domain Sequences for d1d2zc1:

Sequence; same for both SEQRES and ATOM records:

>d1d2zc1 a.77.1.2 (C:26-129) Pelle death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
shldntmairllplpvraqlcahldaldvwqqlatavklypdqveqissqkqrgrsasne
flniwggqynhtvqtlfalfkklklhnamrlikdyvsedlhkyi

Timeline for d1d2zc1:

• d1d2zc1 first appeared (with stable ids) in SCOP 1.55, called d1d2zc_
  
• d1d2zc1 appears in SCOPe 2.07