PDB entry 1crz

View 1crz on RCSB PDB site
Description: crystal structure of the e. coli tolb protein
Deposited on 1999-08-16, released 2000-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.238
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1crzA (A:)
    dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
    paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
    asdevfekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspaw
    spdgsklayvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgs
    lnlyvmdlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqri
    twegsqnqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngt
    mviysssqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl