Lineage for d1crza2 (1crz A:7-140)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24691Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
  4. 24739Superfamily c.51.2: TolB, N-terminal domain [52964] (1 family) (S)
  5. 24740Family c.51.2.1: TolB, N-terminal domain [52965] (1 protein)
  6. 24741Protein TolB, N-terminal domain [52966] (1 species)
  7. 24742Species Escherichia coli [TaxId:562] [52967] (2 PDB entries)
  8. 24743Domain d1crza2: 1crz A:7-140 [33211]
    Other proteins in same PDB: d1crza1

Details for d1crza2

PDB Entry: 1crz (more details), 1.95 Å

PDB Description: crystal structure of the e. coli tolb protein

SCOP Domain Sequences for d1crza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crza2 c.51.2.1 (A:7-140) TolB, N-terminal domain {Escherichia coli}
dsgvdsgrpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevq
paawsalgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaght
asdevfekltgikg

SCOP Domain Coordinates for d1crza2:

Click to download the PDB-style file with coordinates for d1crza2.
(The format of our PDB-style files is described here.)

Timeline for d1crza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crza1